SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363689 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363689
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363689
Sequence length 119
Comment ID3 (Homo_sapiens) inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTSELAPELVISNDKRSFCH
Download sequence
Identical sequences G5BHY6
HGL_H00000363689 XP_004637665.1.9945 XP_004850616.1.39548 XP_005394825.1.28644 XP_010624281.1.5607 XP_010624282.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]