SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364742 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364742
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-40
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 40-83
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000811
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364742
Sequence length 720
Comment FBXO42 (Homo_sapiens) F-box protein 42
Sequence
MASSSDSEDDSFMAVDQEETTLEGTMEQDELTHPGLEAEELKHHRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNITGPSPHPRGGQSQIVIDNATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEDHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SGSREGSLSPARGDGSPVLNGGSLSPGTAVVGGSSLDSPVQALSPSTPSAAEGYDLKMGL
SLAPRRGSLPDQKDLRLGSIDLSWDLKPASSSNHMDGMDNRTVGGSARHLPEQTNGVHTP
PHMASALTGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVP
IPRPGPTGPGQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEK
GRVKWKVFNSTSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences G5BRU7
XP_004850424.1.39548 HGL_H00000364742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]