SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365130 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365130
Domain Number 1 Region: 1150-1318
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.94e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0088
Further Details:      
 
Domain Number 2 Region: 1002-1146
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.12e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 431-492,537-632
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.12e-36
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.049
Further Details:      
 
Domain Number 4 Region: 274-464
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.63e-27
Family Poly(A) polymerase, PAP, N-terminal domain 0.091
Further Details:      
 
Domain Number 5 Region: 1346-1375
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000089
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 6 Region: 1448-1476
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 7 Region: 966-990
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  HGL_H00000365130
Domain Number - Region: 237-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000357
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 833-863
Classification Level Classification E-value
Superfamily ARM repeat 0.0662
Family GUN4-associated domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365130
Sequence length 1481
Comment ZCCHC6 (Homo_sapiens) zinc finger, CCHC domain containing 6
Sequence
MGDAVKPYIVKGTKGRGTVDDDDFRRGYLQQDYLIMDDYVKGHSSKMEKGLPKKKITPGN
YGNTPRKGPYPVSSNPYAFKNPIYSQPVRMNDSHKDQCKRWLFDEVTGNSDNWREFKPGP
RIPVTSRPRKDSFQESEDGYRWQDGRGCRTVRRLFHKDLTSLETMSELEAGSPENKKQRS
RPRKPRRTRNEKYEQDGELDGPVIDESVLSTKELLGLQQAEERLKRDFIDRLKRRPRNCP
TAKYTCKLCDVLIESVAFAHKHIKEKRHKKNMKEKQEEELLTTLPLPTPSQINAVGIAID
KVVQEFGLHNENLEQRLEIKRIMEDVFQHKLRDCSLRLYGSSCSRLGFKNSDVNIDIQFP
AIMSQPDVLLLVQECLKNSDAFTDVDADFHARVPVVVCREKQSGLLCKVSAGNESACLTT
KHLSILGKLEPKLVPLVIAFRYWAKLCSIDCPEEGGLPPYVFALMAVFFLQQRKEPLLPV
YLGSWVDGFSLNKLGNFNLKAIEDDSVIWEYTSNAAGDTNAAKEEAPKEMPVRRGQVSLT
FEVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKESISRESKDWPKKRIAIEDPYS
VKRNVARTLNNQPVFEYILHCLRTTYKYFALPHKVGKSSLPKPLSPVSCISEHSKEVVNY
DPDVQPKDDKLRNSVLTQSPGATTTSTANTGKTQPLSLKEMTKSFGSLPAEEVGNDHITI
CLEDSSCDQGQVERGSKNEKEKIEKEGKCPLTTHVQSLSSSKYGELVACGSTHIYETDGA
LELEDLQNPMGKKCDGFSTLDGKTNVEESIEGASELEDSVDYIAPLIQGQTSEINPFDEE
EEEDEEEEEEEEEEEEEEEEEEEEEPPRLTINRGEAEDGTANEDEFGNTYAGSGDEDAQS
EEEDDELVGPTNHEDLKECGKHVDGALLMELNKINLKGEKAQEENSPVDQSDFIYEFSKL
IFTKGKSPTVVCNLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFSYILDQVCIQCYKDFS
PSTSEEQAREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEG
LDCVRTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRL
LCAYSAIDLRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQ
EIYRGEKKPEIFVDGWNIYFFDQIDELPTYWPEYGKNTESVGQLWLGLLRFYTEEFDFKE
HVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGI
PVKGFPKDYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRRNQE
DTLHRRYPENKDKKSKEEKEIQNKYAEREVSAKEDKSVPCAAQKAKTVRAAVDPGREKIL
RPLMEKWKRQDNKDLREKCCFICGREGHIRKECPQLKVSAG
Download sequence
Identical sequences G5ARL8
HGL_H00000365130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]