SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365280 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365280
Domain Number 1 Region: 64-109
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365280
Sequence length 151
Comment ID1 (Homo_sapiens) inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Sequence
MKVASGSAAPAAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGTRLPALLDEQQVNV
LLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLP
VRAPLSTLNGEISALATETACVSADDRILCR
Download sequence
Identical sequences G5C6K4
XP_004840660.1.39548 HGL_H00000365280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]