SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365891 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365891
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 6.5e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000497
Further Details:      
 
Domain Number 2 Region: 224-353
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.09e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 405-465
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000011
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365891
Sequence length 477
Comment WAS (Homo_sapiens) Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
Sequence
MSGGPVGGRAGGRGGAVAQQNIPSSLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPRG
AQHWTMEHCGALCFVKDNPQKSYFIRLYGLQAGRMLWEQELYSQLVYLAPTSFFHTFAGD
DCQVGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPANEGPPAVPLSLGLP
TVDIQNPDITSSRYRGLPALGPGPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGF
DVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPP
PCRGGNQPTRPPVVGGNKGRSGPLPPVPMGAAPPPPTPRGPPPPGRGGPPPPPPPATGRT
GAGGPSVPPPPPPPPLPSPSTGGGLVPPPPPPTLGSGGGLAPGGGRGALLDQIRQGIQLN
KTPGAMESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences G5BJH7
HGL_H00000365891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]