SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365944-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365944-1
Domain Number 1 Region: 97-279
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-76
Family F-box associated region, FBA 0.00000209
Further Details:      
 
Domain Number 2 Region: 35-114
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000719
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365944-1
Sequence length 312
Comment FBXO6 (Homo_sapiens) F-box protein 6
Sequence
MDEQKRPSASCSLCVGSTSCPPGLCIARAMDPIGINELPENILLELFMHVPARQLLLRCR
LVCSLWRDLIDLMTLWKRRCLLEGFITEDWDQPVADWKVFYFLCSLRRNLLHNPCAEENM
ESWELDANQGNQWKVERLPGDHGTDFPDPKVKKYFVTSYGLCLKSQMVDLKAEGYWEELL
DTFRPDIEVKDWFAARRDCGCTYQIRVQLVSADYITLASFEPPPVTIQQWNDASWTEVSH
TFSDYPPGVRHILFQHGGHDTQFWAGWYGPRVTNSSIIVSNKMARKPAPSAAVSDNVGVE
EAAQVPSHLSAR
Download sequence
Identical sequences G5C512
HGL_H00000365944-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]