SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000367193 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000367193
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily F-box domain 2.33e-21
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000367193
Sequence length 155
Comment FBXO48 (Homo_sapiens) F-box protein 48
Sequence
MQKNSKRNNKLRVCDIELNFVDAEKEKSESQNNFVELLPLEVTFKIFSQLDIQSLCRASV
TCRSWNHTIRNSDSLWKPHCLTVRAVCRREIDNDLENGYPWRVILLRNYQKSKVKYEWLS
GRYSNICSPISLPEKIMCPMDADTWGEILEAELER
Download sequence
Identical sequences G5B7W4
HGL_H00000367193 XP_004849997.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]