SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000367806-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000367806-1
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-23
Family Translational machinery components 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000367806-1
Sequence length 105
Comment RPS16 (Homo_sapiens) ribosomal protein S16
Sequence
MIEPRTPQYKLLEPVLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALAAYYQKYVD
EASKKEIKDILIRYDRTLLVAEPRRCESKKFGDPGARAPYQKSNR
Download sequence
Identical sequences G5ASD8
HGL_H00000367806-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]