SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368192 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368192
Domain Number 1 Region: 706-901
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-19
Family GHMP Kinase, N-terminal domain 0.0064
Further Details:      
 
Domain Number 2 Region: 923-1070
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.12e-19
Family Mevalonate kinase 0.032
Further Details:      
 
Weak hits

Sequence:  HGL_H00000368192
Domain Number - Region: 350-403
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000377
Family gamma-carbonic anhydrase-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368192
Sequence length 1079
Comment FUK (Homo_sapiens) fucokinase
Sequence
MGQLEGVDWTVIILTCQYKDSVQAFQRELEVRQKREQIPTGTLLLAVEDPEVRVGSGGAT
LNALLVAAEHLSARAGFTVVTSDVLHSAWILILHMGRDFPFDDCGRAFTCLPVENPQAPV
EALVCNLDCLLDVMTHRLGPGSPPGMWVCSTDMLLSVPANPGINWNGFRGARVIALPGSP
AYALNHGIYLTDSQGFVLDIYYQGTEAEIQRCVGPDGQVPLVSGVVFFSVETAEHLLATH
VSPPLDACTYMGLDSGARPVQLSLFFDILLCMARNTSREVFLAGRPPEMGQGDMDVAGYL
QGARAQLWRELRDQPLTMAYVPDGSYSYMTSSASEFLHNFTLPGVPRVQIIHSQVEEQQL
LETGSSVVGCLLEGAVHLGPGSVIQHCHLQGPIHIGSGCFVSNLDTAQSEALRGLELQDL
VLQGHHVQLPGSLGRAFTLVGRLDTWERQGAGTYLNMSWSEFFKKTGIRDWDLWDPDTSP
TERHLLNARLFPVLHPSRAPGPQDMLWMLDPREDGGRALRAWRASWRLSWEQLQPHLDRA
ATLASRRGLFFLQAVQKARHVLETRQDLSLRPLIWAAVHEGCPGPLLAMLDQVAAGARDP
GVAARALACVADVLGCMAEGQGGLRSGPAANPEWVRPFSFLECGDLAGGVKALAQERDKW
LSRPALLVRAARHYEGAGQILIRQAVMTAQHFVSTEPVQFPAPGQWVVAECPARVDFSGG
WSDTPPLAYELGGAVLGLAVRVDGRRPIGARARCILEPELWLAVGSRQDEKALKIVCRSL
EDLQDYCQPHASGALLKAAFICSGIVDVRSELPLRQQLLQTFGGGFELHTWSELPHGSGL
GTSSILAGAALAAVQRAAGWAMSTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRS
RAQLPLKVEVEEITVPEGFVQKLNEHLLLVYTGKTRLARNLLQDVLRSWYARLPVVVHSA
HSLVRQTEECTEAFRQGSLPLLGLYLTSYWEQKKLMAPGCEPLAVRRMMDVLAPYVHGQS
LAGAGGGGFLYLLTKEPRQKEVVEAVLAKTEGLGNYSIHLVEVDIQGLSLRLVGSESST
Download sequence
Identical sequences G5C1P8
XP_004842936.1.39548 HGL_H00000368192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]