SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368391-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000368391-5
Domain Number - Region: 89-138
Classification Level Classification E-value
Superfamily Prefoldin 0.00133
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368391-5
Sequence length 164
Comment TPD52 (Homo_sapiens) tumor protein D52
Sequence
MAPAFIRGALIFTMSITSWFQCESLSLVAQILHLTSVDFLASTTGFWAFQVSVHLNHYQM
QVVVLTELSPTEKLGLLRTGPVPEEGEDAAATLSATEALSEEEQDELRRELAKVEEEIQT
LSQVLAAKEKHLAEIKRKLGIGSLQVLKQNIAKGWQDIGIQEDL
Download sequence
Identical sequences G5BIT9
HGL_H00000368391-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]