SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368984-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368984-1
Domain Number 1 Region: 1-168,201-215
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-57
Family Ribonuclease PH domain 1-like 0.0000000256
Further Details:      
 
Domain Number 2 Region: 185-299
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.04e-36
Family Ribonuclease PH domain 2-like 0.000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368984-1
Sequence length 462
Comment EXOSC9 (Homo_sapiens) exosome component 9
Sequence
MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIKISFGTDYGCCIVELGKTRVLGQVS
CELVAPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTES
LCVVAGEKVWQIRVDIHLLNHDGNIIDAASIAAVVALCHFRRPDVSVQGEEVTLYTPEER
DPVALSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGI
MLLKDQVLRCSKIAGVKVAEITELIQKALENDQKVRKEGGKFGFAESIANQRITAFKMEK
APVDTSDVEEKAGEIIAEAEPPSEVVSKPVLWTSGTARIGEGVENSWGDLEDSEKDEDEG
GSHEAVILDNIKMDTGAGVSDIGSQEPDRNKLLEILRDYLYCFPDIFIDDPIVLSDSEEE
EMIILEPDKNPKKIRTQTTSAKQEKAPSKKPMKKRKKKRATN
Download sequence
Identical sequences G5BBT0
HGL_H00000368984-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]