SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368984-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368984-3
Domain Number 1 Region: 1-168,200-214
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.35e-49
Family Ribonuclease PH domain 1-like 0.000000052
Further Details:      
 
Domain Number 2 Region: 184-277
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.32e-31
Family Ribonuclease PH domain 2-like 0.0000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368984-3
Sequence length 364
Comment EXOSC9 (Homo_sapiens) exosome component 9
Sequence
MKETLLLNCEHRFLLCAIEEKKQLDGRQTYDYRNIKISFGTDYGCCIVELGKTRVLGQVS
CELVAPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNLKCTDTES
LCAVAGEKVWQIRVDIHLLNHDGNITDAASIDAIVASCHFRRPDVSVQGEVTLYTPEEHD
PVALSIHHMPICVSFAFFQQGTYLLVDPNEREECVMDGLLVIAMNKHREICTIQYSGGIM
LLKDQVLRCSKITGVKVAEITELIQKTLENNQKIREGVENSWGDLEDSEKDEDEGGSDEA
VILDNIKMDTGAEASDIGSQDDPIVLSDSEEEEMIILEPDKNPKKIRMQTTSAKQEKAPS
KKPM
Download sequence
Identical sequences G5BUR0
HGL_H00000368984-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]