SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369127-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369127-2
Domain Number 1 Region: 66-133
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000196
Family HSP40/DnaJ peptide-binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 38-64
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000017
Family HSP40/DnaJ peptide-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 2-35
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000432
Family DnaJ/Hsp40 cysteine-rich domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369127-2
Sequence length 199
Comment DNAJA1 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily A, member 1
Sequence
MVQQIQSVCMECQGHGERISPKDRCKSSNGRKIVREKKILEVHIDKGMKDGQKITFHGEG
DQEPGLELIETLCGFQKPISTLDNRTTVITSLPGQIVNRGDIKCVLNEGMPIYHRPYETG
HLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELEDFDPNQERWRHYNG
EAYEDDEHHLRGGVQCQTS
Download sequence
Identical sequences G5AVS1
HGL_H00000369127-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]