SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369127-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369127-3
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.37e-33
Family Chaperone J-domain 0.00029
Further Details:      
 
Domain Number 2 Region: 266-346
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.4e-19
Family HSP40/DnaJ peptide-binding domain 0.00086
Further Details:      
 
Domain Number 3 Region: 121-154,221-263
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.83e-18
Family HSP40/DnaJ peptide-binding domain 0.00076
Further Details:      
 
Domain Number 4 Region: 146-217
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.96e-16
Family DnaJ/Hsp40 cysteine-rich domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369127-3
Sequence length 412
Comment DNAJA1 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily A, member 1
Sequence
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKASTIQSSYLNSSLAWF
KQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPVDIFDMFFGGGGRMQRERRGK
NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQI
GPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVGEKKILEVHIDKGMKDGQKITFH
GEGDQEPGLEPGDIIIVLDQKDHAIFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTI
VITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKL
LPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
Download sequence
Identical sequences G5B038
HGL_H00000369127-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]