SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369335 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369335
Domain Number 1 Region: 357-496,529-747,787-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-51
Family Tandem AAA-ATPase domain 0.027
Further Details:      
 
Domain Number 2 Region: 160-213
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000563
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369335
Sequence length 964
Comment FBXO18 (Homo_sapiens) F-box protein, helicase, 18
Sequence
MSSQGCQRNNPEFFLAGQQQCTNDMAKSSSVGQDSCQDSEGDMICPAENTCALPQGDGEA
RLGSSGSALPSRKRSWSFEEERNKATGTSEWDGVTKKTPWHHLSSSCTRPREARQEAEGC
LSWHSAASGEIDQDIEDIGLDPVPDSYYGLLGTLPCQEVPSHICSLPSEVLRHIFAFLPV
EDLYGNLSLVCHLWREIISDPLFIPWKKLYHRYLMNEEQTVSKVDGILLNYGIEKESDLC
VLNLIRFTATTKCSPSVDPERVLWSLRDHPLLLEAEACVRQHLPDLYVAAGGVNVWALVA
AMVLLSSSVNDIQQLLFCLRRPSSTVTMPDITETLYCIAVLLYAMREKGINISNSKKTTI
QLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSESRFLYVTFNKSIAKQAE
VVFPSNVICKTFHSMAYGHVGRKYQLKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKT
LENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRKLGECKEEA
YQMTHDGYLKLWQLSKPLLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYT
FRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHLSGIRGD
TKGQVALLSRTNANVFDEAVRVTEGEVPSRIHLIGGIKSFGLDRIVDIWILLQPEEERKK
RNLIIKDRFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRIPELVERIEKCHI
EDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLAQLPHFRVESFSEDEWNLLY
VAVTRAKKRLIMTKSLENILTLAGEYFLQVELTSNVLKTGVVRCCVGQCNNAIPVDTVLT
MKKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVHSMERTVENIVLPRHEALL
FLVF
Download sequence
Identical sequences G5BP97
HGL_H00000369335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]