SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369494 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369494
Domain Number 1 Region: 296-848
Classification Level Classification E-value
Superfamily Lipoxigenase 9.32e-171
Family Animal lipoxigenases 0.00000592
Further Details:      
 
Domain Number 2 Region: 186-296
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 8.43e-29
Family Lipoxigenase N-terminal domain 0.0055
Further Details:      
 
Domain Number 3 Region: 63-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000123
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369494
Sequence length 848
Comment ALOXE3 (Homo_sapiens) arachidonate lipoxygenase 3
Sequence
MGKKPLLKNSGPGIQVRAEGGGAVAYPSYPGAAGYKDQGERTRSAPGSGGAMVTRDRAEN
RDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRER
SRVEPPGTERGWGSGGWRGPLEARLGKLGQPCCGRPLAPIQQRPRLGFARLLQASVAGHP
SLPLIMAVYRLCVTTGPYLKAGTLDNISATLVGTCGESPKQLLDRVGRDFTPGSVQKYKV
RCSAELGELLLLRLHKERFAFFRKDSWYCSNIIVIAPDGTVIPFPCYQWIEGYCTMELRP
GTARTICQDSLPLLLDQRKRELQARQGCYRWKIYAPGFPRMVDVSSFEEMESDKKFALTK
TIPCADQGDSPGNRYLPGFPMKIDIPSLLHMEPNIRYSATKTASLLFNAIPASLGMKIRG
LLNRKGSWKKLDDIRNIFWCHKTFTTEYVTEHWCEDNFFGYQYLNGVNPVMLHCLSSLPS
KLPVTNDMVAPLLGPDTCLQTELELSQIPGSDSPIFLPTDSEWDWLLAKTWVRNSEFLVH
ENNTHFLCTHLLCEAFSMATLRQLPLCHPIFKLLLPHTRYTLQVNTIARATLLNPDGLVD
QVTSIGRCGLLYLMRTHLAHFTYTNFCLPDSLRARGVLTIPNYYYRDDGLKIWAAIESFV
SDIVGYYYPSDDSVQQDSELQAWVSEIFTQAFLGRESSGFPNRLCTPGQLVKYLTAIIFN
CSAQHAAVNSGQHDFGAWMPNAPSSMRQPPPQNKGTTTLKSYLETLPEVNVTCNNLLLFW
LVSQEPKDQRPLGTYPDQHFTEEVPQRSITAFQSRLAQISRDIRERNQGLPLPYAYLDPP
LIENSVSI
Download sequence
Identical sequences G5B5F1
HGL_H00000369494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]