SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369696 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369696
Domain Number 1 Region: 166-456
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-43
Family WD40-repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 68-135
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000142
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369696
Sequence length 458
Comment FBXW9 (Homo_sapiens) F-box and WD repeat domain containing 9
Sequence
MELPPGQCEDPRVSDDDSGPEPEPDPDAQAEAYVARVFGPLKPGLAPPRASVLSTPAAAP
GALEPRTASRVPTVGPPGLLSLPPELLLQICAYLDAGLVLHVLSRVCHALRDLVRDQVTW
RLRAQRRVRAPYPVVEEEDFDWPTACIELEQHLAHWAEDGRQAEYFCLADGHFASIDSVL
LLQGGTLCLSGSRDRNVNLWDLRQLGAEPSRVLVKALGTQKGSTHKGWVWSLAAQDYRVC
SGSWDSTVKLWDMAADGQQFGEIKGKAAVLCLSYRPDILVAGSYDKKVTIYDPRAGPALL
KSRRLHSSAVLALLADDRHIISGSEDHTLVVFDRRTNSVLQRLQLDSYLLCMSYQEPQLW
AGDNQGLVHVFANRDGCFQLVRSFDVGHKSQITGIKHSLGTLYTTSTDKTIRVHVPTDPP
RTICTRSHHNVLNGICAEGNVVVAASGGLSLEVWRLQA
Download sequence
Identical sequences G5BYX6
HGL_H00000369696 XP_004872433.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]