SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370517 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370517
Domain Number 1 Region: 20-357
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-101
Family Phosphofructokinase 0.000000323
Further Details:      
 
Domain Number 2 Region: 347-571
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.66e-58
Family Phosphofructokinase 0.0000633
Further Details:      
 
Domain Number 3 Region: 687-881
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.27e-38
Family Phosphofructokinase 0.0012
Further Details:      
 
Domain Number 4 Region: 560-624
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.00000000000353
Family Phosphofructokinase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370517
Sequence length 901
Comment PFKP (Homo_sapiens) phosphofructokinase, platelet
Sequence
MGDGSSSTPKTSFPKFLEHLSGAGKAIGVLTSGGGARMNAAVRAVVRMGIYTGAKVYFIY
EGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKAFRTREGRLKAALNLVQLGITN
MCVIGGDGSLTGANIFQEEWSGLLEELAQNGKISEEAVKMHGYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEEGWEENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPEIPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDGGRFKDAVKLRGRSFEGNLKTYKRLAIKLPDDQIPKSNCNVAVINVGAP
AAGMNAAVRSAVRVGIAEGHKMFAVYDGFDGFAKGHIKEIGWADVGGWTGQGGSILGTKR
TLPGKYLEQIAEQIHVHNINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDAFHSVFMMAQARDSHEEFCIPMCVLAATLSNNVPGADFSI
GCDTSLNVVVETCDRIKQSASGTKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXFIIETMGGYCGYLANMGGLAAGADAAYIFEEPF
DIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNVLG
HMQQGGAPSPFDRNFGTKISARAMEWITTKLKGSQGKAKKFVTNDSICLLGIRKRNLLFQ
PVTELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDAGQLEPVHQHGTQGELAD
I
Download sequence
Identical sequences HGL_H00000370517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]