SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370867 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370867
Domain Number 1 Region: 144-461
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-121
Family Transglutaminase core 0.000000000073
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 1.4e-38
Family Transglutaminase N-terminal domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 484-596
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.8e-29
Family Transglutaminase, two C-terminal domains 0.00000228
Further Details:      
 
Domain Number 4 Region: 596-694
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.75e-26
Family Transglutaminase, two C-terminal domains 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370867
Sequence length 695
Comment TGM3 (Homo_sapiens) transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)
Sequence
VTALELQNVDWQVADNRRAHHTGQFSSREVILRRGQSCNIVAFFNRALNSEEGLNLTAET
GPNPSESARTKATFPVASGRSTGGSWAAEVMENNGNALTIAIYSPASAPIGRYTLSLQIS
SKGRVSSVKLGTFVLLFNPWLQADDVFMSNQAERQEYVEEDSGIIFVGSTNRIGMVGWNF
GQYEEDILNISLSILDKSLNFRRDPGTDVARRNDPKYVGRVLSAMINSNDDNGVIAGNWS
GSYTGGLDPRNWNGSVEILKEWKKSGFRPVRFGQCWVFAGTLNTVLRCLGIPSRVITNFN
SAHDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRNDLGPSYNGWQVLDATPQ
ERSQGVFQCGPASVIAVREGDVDRNFDMPFIYSEVNADRITWIYNASNGTQKQNSIDTRS
VGRYISTKAVGSYSRMDITDKYKYPEDSNEERRVQEKALSKLKPNPSFGATSAEDLPREE
RAPSISGRFKVNGVLAVGQEVNLALLLKNLASDRKTVTVNMTAWTIVYNGTLVHEVWKGS
ATVSLDPEEEVQHPVKITYAQYDKYLKADNMIRTTAVCKVSDEAEVVVERDIILDNPTLT
LEVLDRARVRKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLRGNLKIEVPALRPKERSRVR
FEILPTRSGTKQLLADFSCNKFPAIKAMLSIDVVE
Download sequence
Identical sequences G5B4R5
HGL_H00000370867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]