SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371419 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371419
Domain Number 1 Region: 377-565
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.11e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 256-375
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 3.27e-22
Family Domain of poly(ADP-ribose) polymerase 0.0016
Further Details:      
 
Domain Number 3 Region: 875-1028
Classification Level Classification E-value
Superfamily vWA-like 1.03e-20
Family Integrin A (or I) domain 0.044
Further Details:      
 
Domain Number 4 Region: 4-92
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000611
Family BRCT domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371419
Sequence length 1704
Comment PARP4 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 4
Sequence
MTVGIFANCTFCLRVKYLPHQQKKKLQTNIKENGGKISFSLNPQCTHVILDNADALSQYQ
LNYFQKNHIHTATPDFIWQSVKERKLLDLKDYDPAESQDIVPPPDHKMSYSEVKTDDLTL
DIAPEEEIVEITEFCAENVEIPYFSQEFEIAKYNTLEKGGADRGQETVVVELQCAQEPGD
SPFLISAHFLLADGMQTRREFTVKKTSADASEYYEYYIEELKKQGFLLREHFTLEATQLA
SEKLQALLLEEVINSSTLSQEVSSLVEMIWAEAQGHLEHILLKPMNKISLNDVSKAEGIL
LLVKTALKNGETTEQLQKMMTEFYRLIPHKQAATKDINLRLLAKKEDLCQLIRDMVNVCE
THLSKPNPPSLAKYQALRCKIEHVEQNTEEFLRIRKEILQNNHSETPVDILQIFRVGKVN
EATEFLSKLGNVRSLLHGSPVQNIVGILSRGLLLPKLVEDRGVQRTDIGNLGSGIYFSDS
LSTSIKYSPPAETDGSRFLIICDVALGKCVDLFKKDFSLTDAPLGYDSVHGVSQTASVPT
DFEDDEFVVYKTNQVKMKYIIKFCMAGDQMKDFHPQDYSELEGYRPEFLNTLRIDDYQLP
DPKPSSSVKAGLQDASGNLVPLESVHIKGRIIDFVAQVIVFQTYTNQSHVPIEAKYIFPL
DDKAAVCGFEAFINGKHIVGEIKEKEEAQREYRAAVSQGHGAYLMDQAAPDVFTVSVGNL
PPKAKVLIKITYITELSIRGPVAVFFMPASVAPWQQDKALNENLQDAIEKICIKETGTKQ
SFSLTVCIEMPYVIDFISSDTHELKQKRTDCRAVISTMEGSTLDSNGFSLHIGLSNAYLP
RMWVEKHPEKESEACMLVFQPDLDATLPGPANKNEVVICLDCSNSMEGVTFTQAKQIALY
ALSLVGEEQKVNVVQFGTSYKELFSYPKHITNSNVPTEFIKSATPTMGNTDFWKTLRYLG
LLYPSQGVRNVLLISDGHLQNESLTLKLVKRNVLHTRLFTCGTGPTANRHVLRNLAQCGA
GVFEYFNSRSEHSWKKQIEDQMNRLHSPSCHSVSIKWQQLSADAQEPLQAPAQVPSLFHN
DRLLVYGLISHCMQATLCALIQEKEICSMVSTTELQKTTGTMIHKLAARALIRDFEDGIL
HKDEANHEMKKQIMKSLIIKLSKENSLITQFTSFVAIEKRDGNELPFPNTPNILELIDKE
DVDFLPYMSWQEEQEEADMMQPLSAFPEWDEKLQLKGLAKRRLWLSTPKDSEDFEEMVLG
MEEVVQPVALESQSRDVENLLDLAEMDSPRQDGFKAPSETASRKQKAASTSLFAPPLLAV
PNTHSFSFSSSNVRPQAFGFSAPPRQFGQSRSSHGLELDAVPSISLKGLPHLSKPSSLLD
RRAPLAGSMGSAQFDPCKFYPGSENSLFPVVSSELAFPRPPPFFSLGSTTGIMSGGPYIP
HRPSLQSSLCARGAHYSLTEPLLEEASCQPDSSALCSAPPVPKAQLSRSKEAKGKNIGGS
LFGTESNKTPARILAYKSLKRKKKSVMSLNSPLEDEGGTVHQASGKNSVLWAALFSLQTK
DGFWKLTPELGQILNLNTNVLHDFLEQKGIRSLGVKGRECLLDLIATLLVLQFLRTKLEQ
EELIFKSLMKLDDPYISSCVVIPWDCEAVKKASAWARRMERRYASICHRLELGEDWDTAT
KQLLGIQPPASSSSLHCVLYPGQG
Download sequence
Identical sequences G5B1A8
HGL_H00000371419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]