SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371475 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371475
Domain Number 1 Region: 1661-1811
Classification Level Classification E-value
Superfamily BRCT domain 4.36e-44
Family 53BP1 0.0000000795
Further Details:      
 
Domain Number 2 Region: 1813-1917
Classification Level Classification E-value
Superfamily BRCT domain 3.79e-40
Family 53BP1 0.00000222
Further Details:      
 
Domain Number 3 Region: 1484-1552
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-31
Family Tudor domain 0.0000123
Further Details:      
 
Domain Number 4 Region: 1430-1483
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.54e-18
Family Tudor domain 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371475
Sequence length 1918
Comment TP53BP1 (Homo_sapiens) tumor protein p53 binding protein 1
Sequence
MAAVPGKGLQAERGWGGPAGSRRSGGTVRGLEASVGELAQPFGGRWRREQMDPTGSQLDS
DFSQQDTPCLIIEDSQPESQVLEDDSGSHFSVLSRHLPNLQLHRENPVLDAVSNPEQTTE
QGDRNSGFSEHLKENKAADPMDSSHLDTCSSISQVIDRLPQPNRTSSVLGMSLGSVPVAG
EEKEESAEQEQEGVEEDTSEDTTHSLGAEDPASSQLGFGVLELSQSQDVEEHIVPYEVDK
EHLQLITTTSGYTRVSDVDADTVKHEEQCSEDVPVTPQPSKAVRVVEEPSPALGRSEDLP
SGSKVSHAAMETKEQTSVQELLEGELQIQKSPEPEVLSTQEDLFDQSNKTVASDGCCTPS
KEEGGCSLTSTPATTLHVLQLSGQRSLVQESLSTNSSDLVAPSPDAFRSTPFIVPSSPTE
QEGRKDEPVDMSVLSEGVGEPFQKRLQVSDPVQVENTPLPPAGAVSPQALTPVSQSTPVL
TPGSLPVPSQPEFSHDIFIPSPSLEEQSNDGKKGGDLHDSSLTVECSKTSEIEPKNSRED
LGLSLTGDSCKLILSTSEYSQSSKMESLSSHRIDEDGEDSQVEDTEPLSPVLSSKLVPAE
SDSIPMNPAPDGQVELSQIDDKTKGDDTENRDDLSILATGFKGTEETVAEDICIDLTCDS
GSQAVPSPATRTETLSSVLDQEEAMEVTEHHPEEGSSGSEVEEIPETPCESHGEEPKEET
IESVPFHLSLTETQSQVLCLQKEIHKRECPEAMEVETSVISIDSPQKLPVLDQELEHKDQ
EAWEEATSEDSSVVIVDVKEPSPRVDVSYEPFEGVEKCSDSQSWEDVAPEIEPCAENRLE
PQEEKNIEYDGDRKSVTTEKEPVGEDSAQPPLPLVRDDEPPRPDREMQQPQLQEQTDSSL
AEDSRMANAKQLGPGREAGQLEKAPAHASQSFCESSSGISNYPESTIATSVVMSESMVET
NDAIHGSEKGDSGAAPEVDEKLCLRMKLVSPETEASEESLQFSLEKPATGERRNGSTAVA
EAVASPQKTVSVFSCICEVRQEEMAQGEDLPSASVRGNLLHYPSTQEEEKKAKLEGDHRI
RQSEQPVKTVSLLEDPESPASQQTVSQGLSSPRGEVTETDTQEGQQEERDAHQEEPSKAT
IERPTQNNIGIQTLEHSLWVPETISAATQTVKNVCEQGTSTVDQSSGKQDAMVQTERASD
EKPVGAPGDDTESLHSQGEEEFDMPQPPQGHVLHRHTRTIREVRTLVTRVITDVYYVDGT
EVERKVTEETEEPIVECQECETEVSPSRTGGSSGDLGDVSSFSSKASSLHRTSSGTSLSA
LHSSGSSGRGAGPLKGKSSGTEPTDFALPSTRGGPGKLREAVVPGPLGIEDISPSVSPDD
KSFARILPRIPDTTRRADVGAGAVHRSDSPEIPFQAAAGSDGLDASSPGNSFVGLRVVAK
WSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFS
AGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKA
ADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKIMESPRASVGVPSGKRKLITSE
EDRSPAKRGRKSAPVKPGAVGAGEFVSPCESGDNTADPSVLEEQRGPLPLNKTLFLGYAF
LLTMATTSDKLASRSKLPDLPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEA
QCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSL
EEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIAL
GVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHNYVSH
Download sequence
Identical sequences G5BM49
HGL_H00000371475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]