SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371882 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371882
Domain Number 1 Region: 9-151
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.19e-31
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371882
Sequence length 170
Comment HSP90AB2P (Homo_sapiens) heat shock protein 90kDa alpha (cytosolic), class B member 2 (pseudogene)
Sequence
MEEEEEEEVETFTFQAEIAQLMSLINNTFYSGLIPNSSDALDKIRYESLTDPSKLDSSKE
LHIYLIPNKQDRTLTIVDTGIGMTRVNLMDDFSTITKLETKAFMEALQVGTDNSMTGRSG
VGFHLVAERVTVTTKQSDDEQYAWNLQQAGPSMRTDKVNSVAEEQRLSCI
Download sequence
Identical sequences G5B255
HGL_H00000371882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]