SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373918-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373918-1
Domain Number 1 Region: 68-305,348-426
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.77e-112
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 530-619
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.29e-20
Family Anticodon-binding domain of Class II aaRS 0.00049
Further Details:      
 
Domain Number 3 Region: 16-51
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000051
Family a tRNA synthase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373918-1
Sequence length 633
Comment GARS (Homo_sapiens) glycyl-tRNA synthetase
Sequence
MDGAGAEDVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQP
KDDIVDRSKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQ
ILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAE
KKSEMESVLAQLDNYGQQELGDLFVNYNVKSPSTGNDLSPPVPFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHF
VDPNEKDHPKFQNVADIYLYLYSAKAQVSGQSARKMRLGDAVEQGVINNSVLGYFIGRIY
LYLVKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHAR
ATKVPLVAEKPLKEPISFLVPPKLGPKPNILLMFNVVQFEPNKGAVGKAYKKDAKLVMEY
LAICDECYIAEMEMLLNEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHAEALTRNGVSHK
VDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPGIV
RDLANGSITWADVEARYPVFEGQETGKKETIEE
Download sequence
Identical sequences G5BRM9
HGL_H00000373918-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]