SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000374354 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000374354
Domain Number 1 Region: 65-218,249-263
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-50
Family Ribonuclease PH domain 1-like 0.0000000953
Further Details:      
 
Domain Number 2 Region: 234-290
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.45e-16
Family Ribonuclease PH domain 2-like 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000374354
Sequence length 305
Comment EXOSC8 (Homo_sapiens) exosome component 8
Sequence
MLQSDTLLELTSEGDSHYFYSTRTHFFPHRSRQRAGGHGGGPLRGKGLLLARETGVEGTP
EPRSPKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAVPPKDA
PDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISSGKLAW
VLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEETALAEVNLKKKSYLNIRTHP
VATSFAVFDDTLLMVDPTGEEEHLATGSLTVVMDEEGRLCCLHKPGRFLLPEFQAYGREN
SVNIY
Download sequence
Identical sequences HGL_H00000374354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]