SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000375863 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000375863
Domain Number 1 Region: 197-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-30
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.00000000348
Family SAP domain 0.00035
Further Details:      
 
Domain Number 3 Region: 407-555
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000199
Family Nucleotide and nucleoside kinases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000375863
Sequence length 708
Comment HNRNPUL1 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein U-like 1
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELEADDEPGQPGHN
NEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMENMTRQNQFYESQVIKQEN
ESGYDRRPLDLEPLQQAYRPVEVKTEMKQEAPPSFLPPEASQLKPDRQQFQSRKRPYEEN
RGRGYFEHREDRRWVFGAPVTLIPGDNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASY
GVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKK
STNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYP
HVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAECEILMMVGLP
AAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR
LIQIAARKKRNYILDQEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLF
IELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGFRGRGGGGGFQRYDSRGPPGSNRG
GFQNRGGGSSGGGNYRGGFNRSGGGGYNQNRWAPAYNYGSYGGYNPAPYTPPPPPTAQTY
PQPSYNQYQQYAQQWNQYYQNQAQWPPYYGNYDYGSYSGSTQGGTSTQ
Download sequence
Identical sequences G5AZS9
HGL_H00000375863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]