SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377107-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377107-3
Domain Number 1 Region: 35-100
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-20
Family Capz alpha-1 subunit 0.0001
Further Details:      
 
Weak hits

Sequence:  HGL_H00000377107-3
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377107-3
Sequence length 108
Comment CAPZA2 (Homo_sapiens) capping protein (actin filament) muscle Z-line, alpha 2
Sequence
MRRREGAAHAFAQYNLDQFTPVKIEGYEDQVIDILKIQVNYYKDVNVQLVSHKDIQDSLT
VANEVRTAKEFIKIVEAEENEYQTAISKNYQTMSDTTFKASTVASDSY
Download sequence
Identical sequences G5BMN7
HGL_H00000377107-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]