SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377280 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377280
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 61-139
Classification Level Classification E-value
Superfamily F-box domain 4.19e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377280
Sequence length 319
Comment FBXO8 (Homo_sapiens) F-box protein 8
Sequence
MGQGLWRVARNQQLQQEGYSEQGYLTREQSRRMAVSNISNTGQRKQVQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYSKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences G5B404
HGL_H00000377280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]