SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377814 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377814
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.14e-46
Family HD domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377814
Sequence length 179
Comment HDDC3 (Homo_sapiens) HD domain containing 3
Sequence
MDSEVAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGTQVRRLVEEVTDDKTLPKLERKRQQVEQAPRSSPGAKLVKL
ADKLYNLRDLNRCTPAGWSEHRVQEYFEWAAQVVKGLQGTNQQLEEALKQLFKERGLTI
Download sequence
Identical sequences G5CAB4
XP_004852863.1.39548 HGL_H00000377814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]