SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378405 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378405
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 9.94e-48
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000881
Further Details:      
 
Domain Number 2 Region: 180-361
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.63e-35
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378405
Sequence length 373
Comment BCKDK (Homo_sapiens) branched chain ketoacid dehydrogenase kinase
Sequence
MEMARERSKTVTSFYNQSAIDVAAEKPSVRLTPTMMLYSGRSQDGSHLLKSGRYLQQELP
VRIAHRVKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLL
DDHKDVVTLLAEGLRECRKHIEGEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKLDFVG
IICTRLSPKKIIEKWVDFARRLCEHKYGGAPRVRINGHVAARFPFIPMPLDYILPELLKN
AMRATMESHLDTPYNVPDVVITIANNDIDFIIRISDRGGGIAHTNLDRVMDYHFTTAEAS
TQDPRISPLFGHLDMHSGSQSGPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLR
LRHIDGQEESFRI
Download sequence
Identical sequences G5BYC5
HGL_H00000378405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]