SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378813 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378813
Domain Number 1 Region: 564-628
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378813
Sequence length 674
Comment TCF3 (Homo_sapiens) transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Sequence
MSQPQRMAPVGTDKELSDLLDFSMMFPLPVANGKGRPTSLAGAQFGGSGKGGERGTYPAF
GREAGVGGLTQAGFLPGELALSSPGPLSPSGIKGSSAYYPSFPSNPRRRAADSGLDSQPK
KGRKVPPGLPSSVYPPSSGDDYGRDAAYTSDKTPGSTYPAPFYMADGSLHPSAELWSPPG
QAGFGPMLSGASSPLPLAPGAGSSVGSGAFGGLQQPERMGYQLHGAEGNGALPAVASFSS
GPGAAYSSVSSHTPPVTGADSLLGSRGTSAGSSGDALGKALASIYSPDHSSSNFSPSPST
PAGSPHGLAGTSQWSRAGAPGALSPSYDGGLHALVLTAATHPQNKMEDHLDEAIHVLRSH
AVGTAGDMHSLLPGHGALASSFASPMPLGGRHTGLVGGGHSEDGLGASASLLHNHAALPS
QPGTLPDLARPPDSYSGLGRAGAAVGAGEIKREEKEDEENTSAADPAEEERKELKAPRAR
TXHTLPSPKCHPQPPHPHRDMFPGHPRAHFQGVSTVLKHRSQCPTWSHAPQTIVTHAHRP
SYRCTPTLAVTHSTEEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQLHL
KSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLPAA
HPGLNDAHNPTGHM
Download sequence
Identical sequences G5BW54
HGL_H00000378813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]