SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379174 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379174
Domain Number 1 Region: 291-492
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.25e-55
Family DNA polymerase beta-like 0.0000103
Further Details:      
 
Domain Number 2 Region: 137-227
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 8.24e-23
Family DNA polymerase beta, N-terminal domain-like 0.00033
Further Details:      
 
Domain Number 3 Region: 230-287
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.44e-17
Family DNA polymerase beta-like, second domain 0.00049
Further Details:      
 
Domain Number 4 Region: 31-122
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000149
Family DNA topoisomerase II binding protein 1, TopBP1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379174
Sequence length 493
Comment POLM (Homo_sapiens) polymerase (DNA directed), mu
Sequence
MLPKRRRVRARSPGGPAASSTSSSALFPGVAIYLAEPRMGRSRRAFLTRLAMSKGFRVLD
TYSSEVTHVVMEGTSAGEAACWQENEAAPPPGCPRPALLDISWFTESMAAGQPVPVEGRH
RLEEAELRKGPPNPAAMPAYACQRSTPLMHHNSSLSEALETLAEAAGFEGSEGRLLSFCR
AASVLRALPWPVTVLSQLQGLPNFGEHSSRIVQELLERGVCEEVKRVRSSERYRTMKLFT
QVFGVGVKTANRWYQEGLRTLDELREQPQRLTRQQRAGLQHHRDLCTPVGRPDAEALQRL
VEATVGQALPGATVMLTGGFRRGKLQGHDVDFLITHPEEGREVGLLPSVVCQLQSQGLVL
YHQHQRSHLGDPDHLARQSHTMDAFERSLCILRLLQPSQPAKGADSEPRPWRAVRVDLVV
APWSQFPFALLGWTGSKLFERDLRRFSRKEKGLCLNSHGLFDPEQKSCFHVASEEDIFRH
LGLAYLPPEQRNA
Download sequence
Identical sequences G5ASQ9
HGL_H00000379174 XP_004839985.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]