SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379766 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379766
Domain Number 1 Region: 11-212
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.46e-53
Family GHMP Kinase, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 215-269,452-515
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 9.66e-24
Family Galactokinase 0.0073
Further Details:      
 
Domain Number 3 Region: 595-657
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000000118
Family Galactokinase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379766
Sequence length 661
Comment GALK2 (Homo_sapiens) galactokinase 2
Sequence
MCNLKDSTLVFRLLKLKEMFKSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQD
MLIAVEPVETYILQLANTNPLYPDFSTSVNNIQIDKTKLLWHNYFLCGFKGIQEHFGLCD
PTGMNCLVDGTIPPSSGLSSSSALVCCAGLVTLTVLGMRLSKVELAEICAKSERYVGTEG
GGMDQSISFLAEEGTAKFIEFSPLRATDVRLPSGAVFVIANSCVEMNKAATSHFNIRVME
CRLAAKLLAKHKSLQWDKVLRLEEVQAQLGISLEDMLLVTDDALHPEPYSPEEICRCLGI
SLEELRTQILSANTRDGKRGREEEDEKKRREEKSFDEMRERRKADVCALTVLMDTRMHTN
LKKPQHTQPSKLTTKGQCFELTGDIEAAVTAQLKTLRKEDSRAAEESDEKNGISVERNWP
VACSYVIVPRRLKLQLLLTPHPDSGKVPVFKLYQRAKHVYSEAARVLQFRKVCEDSPEDA
VAQLGELMNQSHRSCRDLYECSCPELDQLVDICRIMEQGRGEGPPAVPFPGWGRRSWCQP
SPRCSCPSASLYRDAATRESQLALSALRPCPEKPQRSSPALQHGARQAGQGRGTSGAQGS
RLTGAGWGGCTVSLVPEDVLPGFLARVHAAYYQGSEHSAAPGQHSLFATKPGGGALVFLE
A
Download sequence
Identical sequences G5CA44
HGL_H00000379766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]