SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379861 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379861
Domain Number 1 Region: 342-379
Classification Level Classification E-value
Superfamily SAP domain 0.000000000293
Family SAP domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379861
Sequence length 902
Comment MKL1 (Homo_sapiens) megakaryoblastic leukemia (translocation) 1
Sequence
LKSPAAFHEQRRSLERARTEDYLKRKIRSRPERAELVRMHILEETSAEPSLQAKQLKLKR
ARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSSDAL
SPEQPASHESQGSVPSPLEARISEPLPSATSVSPSQVLSQLPLGPDSGETLFVAEQPPLP
PPPLLPPSLTNGTAIPTAKPAPTLIKQSQPKSAGEKAQRSKKAKELKPKVKKLKYHQYIP
PDQKQDKGAPTMDSSYARILQQQQLFLQLQILNQQQQQHYNYQTILPAPPKTAGEALGSS
GAPPVRSLSATNGCTSSSAPGPGGLARQNSAPLSGKPGALPANLDDMKVAELKQELKLRS
LPVSGTKTELIERLRTYQDQVGPVPGAPKAPTAPSLLSKAGEVVVAFPAARLSTGPALVT
AGLAPAEVVVATVTSNGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDAFGETVTSP
LTQLTLQASPLQVLVKEEGAAREPEGLDKDQMLQEKDRQIEALTRMLRXXXXXXVELLRL
QLEREKRAQQPGAPVKQEGGLPSCPLSHQPPAAARPFSPGLSVPAANHGDARAVAVKQEA
APEPEPMPGTQLLLGSQASSLLQGVTPPTLVTDATGTHLVLTVTNKNTDSPGLPGGSPLQ
ALSQPGSPAPGPPAQMDLEHPSQTPFGTPASLLKKEPPGYKEAVTQQPKQENGSSSQQMD
DLFDILIQSGEISVDFKEPPSLPGKEKPPSAAACGSPLAAQPLPAAELPQAAPPAPGSPV
LPGRLEDFLESSTGLPLLTGGHEGPEPLSLIDDLHSQMLSSSAILDHPPSPMDTSELHFA
PEPNSGVGLDLADGHLDSMDWLELSSGGPVLSLAPLSTAAPSLFSTDFLDGHDLQLHWDS
CL
Download sequence
Identical sequences G5AYW6
HGL_H00000379861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]