SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380414 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380414
Domain Number 1 Region: 280-321
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000000000353
Family DEK C-terminal domain 0.00018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380414
Domain Number - Region: 114-154
Classification Level Classification E-value
Superfamily SAP domain 0.000147
Family SAP domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380414
Sequence length 323
Comment DEK (Homo_sapiens) DEK oncogene
Sequence
MSSSAPAAEEEGTPAQSASEKEPDVPDPREESEEEEDDDEEDEEEEKEKSLIVEGKREKK
KVERLTMQVSSLQREPFTIAQALIREIFQVSSLKKNVGQFSGFPFEKGSIQYKKKEEMLK
KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKISSKGSKKERNS
SGMARKAKQNKCLEILSDESSSDEDEKKNKEESSDDEDKESEEEQPPKKTSKKEKTKQKT
TSKSKKSVKSANVKKADSSTTKKNQNSSKKESESEDSSDDEPLIKKLKKPPTDEELKETV
KKLLASANLEEVTMKQICKEVIR
Download sequence
Identical sequences G5AXU0
HGL_H00000380414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]