SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380494-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380494-2
Domain Number 1 Region: 280-362
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380494-2
Sequence length 364
Comment MYCL1 (Homo_sapiens) v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)
Sequence
MDFDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGSGPGAGDLAPGIGP
PEPWPGGGAGDEAESRGHSKAWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKTPAAPDCTPSLEAGNPTPATPCQLGEPKTQACSGSESPSDSEGEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEAPERSPQEETMER
EVHKEKQDEKDEELVSSPPVESEAPPSCHPRPVSSDTEDVSKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LSGY
Download sequence
Identical sequences G5C409
XP_004851094.1.39548 HGL_H00000380494-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]