SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381648-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381648-2
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily SAP domain 3.05e-19
Family SAP domain 0.0001
Further Details:      
 
Weak hits

Sequence:  HGL_H00000381648-2
Domain Number - Region: 332-387
Classification Level Classification E-value
Superfamily RING/U-box 0.0812
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381648-2
Sequence length 393
Comment PIAS2 (Homo_sapiens) protein inhibitor of activated STAT, 2
Sequence
NMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRT
LEGLSDLSAIKSSVFSLDSSSSPVEPDLAVAGIHSLPSTSVTSHSPSSPVGSVLLQDTKP
TFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQV
REICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPP
KNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRL
KMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLTCPLGKMRLTIPCRAVTCTHLQCF
DAALYLQMNEKKPTWICPVCDKKAAYESLILDG
Download sequence
Identical sequences G5C616
HGL_H00000381648-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]