SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000383762 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000383762
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.05e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0062
Further Details:      
 
Domain Number 2 Region: 270-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.8e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000383762
Sequence length 501
Comment FMO9P (Homo_sapiens) flavin containing monooxygenase 9 pseudogene
Sequence
KRVAVIGAGASGLGAMKSCLEEGLEPLCFEKSKDIGGVWRYEETPESGRPGLYKSVTLNT
SKEMTAFSDYPFPDHYPNYLHHSRMMEYLRMYTKHFGLMKYIQFLSKVCAVRKRPDFSSS
GQWDVVVEADGKQKTYTFDGVMICSGRYTEKYLPLQDFAGIQNFSGTYLHSWEYKHPDSF
VGKRVVVIGLGNSGVDVASEISHVAEQVFLSTRQGAWIWSRVWDHGNPMDATLFTRYNRT
IEKIIPTFLLNRWAENKLNARFNHANYGLQPKHRIFSHRTVFSDDLAKHIITGRVLMKPN
VKEFTATSAIFEDGTEEDVDAIVFATGYSWTAPFLEADSGILDSQHSLFKFVFPPQLEKP
TLAFIGVVQPVGPLIPSAEIQSRWAVRVFKGLKILPSESDMMADINRSRKKMTNTSVQSP
GEGQQVQYINYMDEIASELGVKPNLFSLFLWDPKLAKEIFYGPCTSYQYRLQGPGKWCRA
RKAILTQRDRMLKPLRTRVVT
Download sequence
Identical sequences G5AQ38
HGL_H00000383762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]