SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384038 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384038
Domain Number 1 Region: 259-751
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.04e-108
Family Phosphofructokinase 0.0000261
Further Details:      
 
Domain Number 2 Region: 1-282
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.59e-57
Family Phosphofructokinase 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384038
Sequence length 785
Comment PFKL (Homo_sapiens) phosphofructokinase, liver
Sequence
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKPATWLSVSNIIQLGGTVIGSARC
KAFTTREGRRAAAFNLVQRGITNLCVIGGDGSLTGANIFRSEWGSLLEELVREGRISETA
AQTYSHLNIAGLVGSIDTDMTIGTDSALHRIMETRSRGSRLNIIILAEGAIDRNGKPISS
SYVKDDVGGQESTARLSHEQLVVQRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAV
MALLEATPDTPACVVSLSGNQSVRLPLLGCVQVTKDVQKAMDDKRFDEAIQLRGRSFENN
WNIYKLLAHQKVSKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQGHTVYVVHDGFEG
LAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKAHMEAIVENLRTHNIHALLVIGGFEAY
EGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASG
TKRRVFIVETMGGCCGYLATVAGIAVGADAAYVFEDPFNIHDLQANVEHMTEKMKTDIQR
GLVLRTGADPGSQAPSPCLAHLSAPQANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFL
YNLYSSEGKGANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRT
NVLGHLQQGGAPTPFDRNYGTKLGVKALLWMSDKLRAVYRRGRVFANAPDSACVIGLRKK
VVAFSPVTELKEDTDFEHRMPREQWWLNLRLMLKMLAHYHISMADYVSGELEHVTRRTLS
LDTGF
Download sequence
Identical sequences G5BG13
HGL_H00000384038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]