SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384048 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384048
Domain Number 1 Region: 67-158
Classification Level Classification E-value
Superfamily BRCT domain 5.89e-26
Family DNA topoisomerase II binding protein 1, TopBP1 0.064
Further Details:      
 
Domain Number 2 Region: 706-825
Classification Level Classification E-value
Superfamily BRCT domain 3.14e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.074
Further Details:      
 
Domain Number 3 Region: 561-637
Classification Level Classification E-value
Superfamily BRCT domain 3.4e-17
Family DNA ligase 0.012
Further Details:      
 
Domain Number 4 Region: 466-563
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000144
Family BRCT domain 0.06
Further Details:      
 
Domain Number 5 Region: 2-70
Classification Level Classification E-value
Superfamily BRCT domain 0.000000567
Family BRCT domain 0.07
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384048
Domain Number - Region: 378-450
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00194
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384048
Sequence length 927
Comment PAXIP1 (Homo_sapiens) PAX interacting (with transcription-activation domain) protein 1
Sequence
KVIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGALL
PVNGFSPESCQIFFGVTACLSQVSSEDRSALWALVTFHGGNCQLNLNKKCTHLIVPEPKG
EKYECAVKRASIKVVTPDWVLDCVSEKTRKDEAPYHPRLIIYEEEEEEEEEEEEEGENEE
QDSQNEGSTEEKSSPASSQEGSPSRDQPFLPKPSAETSKGELMFDDSSDSSPEKQERNLN
WTPAEVPHPTAAKRRLPQGKEAGLINLCANVPPVPGNILPPDVRGNFMASGQTLQSSERA
EMITTWSPAVRTLRNITNNADIQQINRPSDVAHILQSLSAPTKALEPQVGHGQQGHGSAS
TGAMLLGPTRGAPDTHLPPPHRQPLPQHPLQHPVLHLQPPQMPQQPCPQQQHPFPQQPHP
AAPHLGQAAPAMQHQPPHLQPPPPQQPPQLPLCGHDPAVEIPEEAFLLGCVFAIAEYPEQ
MSDKQLLATWKRIIQAHGGVVDPTFTSRCTHLLCESQVSSMYAQAIRERKRCVTAHWLNT
ILKRKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRNDLKLMAYLAGAKYTGYL
CRSNTVLICKEPSGLKYEKAKEWRIPCVNAQWLGDILLGNFEALRQIQYGRYTAFNLQDP
FAPTQHLVLNLLDAWRVPLKVSPELLMGVRLPPKPKQNEVSSIQPSSKRARIEDLPPPTK
KLTPELTPFVLFTGFEPGQVQQYIKKLYVLGGEVAESAQKCTHLIASKVTRTVKFLTAIS
VVQHIVTPEWLEECFKCQKFVDEQNYILRDAEAEVLFSFSLEESLKRAHVAPLFKAKYFY
ITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLVEHKQNKSLSEIIVISCENDLHLCREY
FARGIDVHNAEFVLTGVLTQTMDYESY
Download sequence
Identical sequences G5AVC7
HGL_H00000384048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]