SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384120 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384120
Domain Number 1 Region: 40-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 2 Region: 169-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384120
Sequence length 533
Comment NETO1 (Homo_sapiens) neuropilin (NRP) and tolloid (TLL)-like 1
Sequence
MIHGRSLFHIVASLIILHFSGATKKGTEKQTTSETQKSVQCGTWTKHANGGIFTSPNYPS
KYPPDQECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPE
GIVESVQILKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPAQPAKPLIPPMNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences G5BHS3
HGL_H00000384120 XP_004862019.1.39548 XP_004862020.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]