SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384239 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384239
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 1.99e-39
Family Globins 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384239
Sequence length 154
Comment MB (Homo_sapiens) myoglobin
Sequence
MGLSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKSLKSEDEMRGSE
DLKKHGSTVLTALGGILKKKGQHAAELAPLAQTHATKHKIPVKYLEFISEAIIQVLQSKH
PGDFGADAQGAMRKALELFRNDIGAKYKELGFQG
Download sequence
Identical sequences A0A0A7HRI5
HGL_H00000384239 XP_004844814.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]