SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386178 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386178
Domain Number 1 Region: 217-300
Classification Level Classification E-value
Superfamily E set domains 5.04e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386178
Domain Number - Region: 307-354
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0589
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386178
Sequence length 539
Comment EBF2 (Homo_sapiens) early B-cell factor 2
Sequence
MDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVE
IERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAYEG
QNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDSEQGHPSNPEAQCEVVLST
TVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGD
NFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYT
ALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAA
DIAEALYSVPRNPSQIPALSSSPVHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSI
SPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPT
VGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM
Download sequence
Identical sequences G5BYA3
HGL_H00000386178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]