SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386621 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386621
Domain Number 1 Region: 211-356
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.76e-32
Family AlaX-like 0.014
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.03e-20
Family Co-chaperone p23-like 0.00019
Further Details:      
 
Domain Number 3 Region: 152-210
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000145
Family AlaX-M N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386621
Sequence length 559
Comment AARSD1 (Homo_sapiens) alanyl-tRNA synthetase domain containing 1
Sequence
MEFCVEDSTDVHVVLEDHRVVFSCKNGDGVELCNEIEFYAKVNSKDSQDKRSGRSVTCFV
RKWKEKVAWPRLTKEDIKPVWLSMDYDNWRDWEGDEEGELAQVEHYAELLQKVSTKRLPP
AMDDLDFSTVVVACRPAELPAEVGKGQKVVRHGFQVVLEDTLLFPEGGGQPDDRGMIDNV
PVLRVTRRGAEADHFTETPLAPGSRVQVHVDWERRFDHMQQHSGQHLITAVAEHLFGLKT
TSWELGRLQSVIELDSPSVTAEQVAAIEQSVNEKIRARLPVSVRELSPDDPEVEQVRGRG
LPDDHVGPVRVVTIEGVDANMCCGTHVSNLSDLQVIKVLGIEKGKKNKTNLLFLAGHRVL
KWVARSEKALTALLKYIPVPILSPSGAPSVLRAWTPLALPPAGCGAEDHVQVVTKLQSSV
KLLQKNNLNLLRDLAVHVARTLRDSPDWGGVVALHRKEGDSEFMNIVANEIGAEDTLLFL
TVGDEKGPGLFLLAGPPEAVETLGPRVAEVLEGKGVGKKGRFQGKATRMSRRTEAQVLLR
NHASLRAQRAELGAGSTGQ
Download sequence
Identical sequences G5BN90
HGL_H00000386621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]