SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386923 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386923
Domain Number 1 Region: 22-188
Classification Level Classification E-value
Superfamily Lysozyme-like 4.31e-16
Family G-type lysozyme 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386923
Sequence length 188
Comment LYG1 (Homo_sapiens) lysozyme G-like 1
Sequence
MSALWLLLGLLALTGSSESSNWGCYGNIRTLDSPGASCGIGRRYGLTYCGVRASERLAEI
DLPYLLRYQPIVRTVGRKYCMDPAVIAGVLSRESLRSRVPVNVVQDINVFAPKSWISESQ
VSQMTKVLTTRIKEIQRTFPTWTPDQYLRAGLCSYSEAAGFVRRGQDLSCDFCNDVLARA
KYFKRHGF
Download sequence
Identical sequences G5BMS6
HGL_H00000386923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]