SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386939 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386939
Domain Number 1 Region: 14-168
Classification Level Classification E-value
Superfamily Lysozyme-like 7.67e-23
Family G-type lysozyme 0.00000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386939
Sequence length 168
Comment LYG2 (Homo_sapiens) lysozyme G-like 2
Sequence
MTMETSGVRCDISNLLSCGIRGSEMFADMDLNAIRTYQTLIKEVGQRYCVDPALIAAVIS
RESHGGVVLQRGWDHRGLKFGLMQLDKSVHPTGAWDSKEHLSQGVGILAENIKVIQRKFP
MWSVDQHLKGGLSAFKSGTEAIAAPENIDSDYVNDVIARARFYKSHGF
Download sequence
Identical sequences G5BMS8
HGL_H00000386939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]