SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387536 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387536
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 1.57e-58
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000355
Further Details:      
 
Domain Number 2 Region: 184-352
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-26
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387536
Sequence length 400
Comment PDK3 (Homo_sapiens) pyruvate dehydrogenase kinase, isozyme 3
Sequence
XLLKQSVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLKELPVRLANTMREVNL
LPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPKVLDNFLQVLIKVRNRHNDVVPTM
AQGVIEYKEKFGFDPLISSNIQYFLDRFYTNRISFRMLINQHTLLFGDDTNPAHPKHIGS
IDPTCDVADVVKDAYETAKMLCEQYYMIAPELEIEEFNAKAPDKPIQVVYVPSHLFHMLF
ELFKNSMRATVELYEDRKEGCPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYS
TAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESF
ERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ
Download sequence
Identical sequences HGL_H00000387536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]