SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387555 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387555
Domain Number 1 Region: 28-57,175-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.78e-60
Family G proteins 0.0000000212
Further Details:      
 
Domain Number 2 Region: 57-177
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.35e-42
Family Transducin (alpha subunit), insertion domain 0.000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387555
Sequence length 350
Comment GNAT1 (Homo_sapiens) guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1
Sequence
MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLE
ECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSAHQDDARKLMHMADTIEEGTMPKEMS
DIIQWLWKDSGIQACFERSSEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGI
IETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMH
ESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYDGPNTYEDAGNYIK
VQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences G5BZY4
XP_004834140.1.39548 HGL_H00000387555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]