SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387710 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387710
Domain Number 1 Region: 401-683
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.7e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 224-400
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000764
Further Details:      
 
Domain Number 3 Region: 685-792
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.51e-28
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 162-222
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000161
Family TGS domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387710
Sequence length 802
Comment TARS (Homo_sapiens) threonyl-tRNA synthetase
Sequence
MLREADCNEDHLGISLGSPKCKTEYGLPDSLGILSEVGEVTEGTTDMKRIHFLTPYADKI
ESSFFRPVLWSKNYAGGRSLVSEKASCPLEEMGGEEKPVNAGEEKRKEGGKKKNKEGSGD
GGRAELNPWPEYINTRLEMYNKLKAEHDSILAEKAEKHSRPIKVTLPDGKQVDAESWKTT
PYQVACGISQGLADNTVVAKVNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIM
GEAMERVYGGCLCYGPPIESGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEV
KKESLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNS
STYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPG
SCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEV
EKELFALKPMNCPGHCLMFDHRPRSWRELPLRIADFGVLHRNELSGALTGLTRVRRFQQD
DAHIFCAMEQIEDEIKGCLNFLHTVYNVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLEN
SLNEFDQKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGD
DKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQF
HDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTI
SETIERLQQLKQSRSKQAEEEF
Download sequence
Identical sequences G5BJ35
HGL_H00000387710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]