SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388360 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388360
Domain Number 1 Region: 419-523
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-22
Family Translational machinery components 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388360
Sequence length 523
Comment FAM164C (Homo_sapiens) family with sequence similarity 164, member C
Sequence
MAGLQLAPQLPVGVMFPHNKAAAPGLHSAKQDPYEQGDSSQQSSMGHLKSFQQKPLNKKE
LALDNVYTHPKWNTCTKARSYSYSHCAGISQRNSGSNPQGQGKGFLYSSSPQSGYPKAND
QDFIPFTKKRVGVDRAYPLKPVVHRKSHSTGEAGTDRNQNVYPRPPDPREFSDSNFGLRN
WVNSSVLASMQGEAMANLHRTNWMQVQRLEAAGESLEEEIRRKESLLREKLKKTEEELRR
IQREKEQAKENEEQELQRMIQLRRDKGSNITIIYKPVFSPEFGTEEVSSRDRREDETWGQ
PQENSSPIQFSDYGIQKFKKERLVAISKIQDQASRPLVEEFFQPSEEAGSNLQGSTRSSS
LSRAPESSRSSGSTEEPELGKCSHCGRTFLLLRLERHSTICSKMQGSKRKVFNSSRARAK
GTELEQYLNWNGPATVKVRFAGVDIRVRVKGGGHVAQIYAIRQSISKALVVYYQKYVDEA
SKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARGHYQKSYR
Download sequence
Identical sequences HGL_H00000388360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]