SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389716 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389716
Domain Number 1 Region: 59-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000106
Family HLH, helix-loop-helix DNA-binding domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389716
Sequence length 206
Comment MXD3 (Homo_sapiens) MAX dimerization protein 3
Sequence
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHHSPGPIHRRRKRPPQAPGALDSGRS
VHNELEKRRRAQLKRCLEQLKQQMPLGADCVRYTTLSLLRRARMHIQKLEEQEQRARWLK
EKLLSKQQCLQRQLEQLQGLPKAGERERLRADSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRSFSSGQEHSYSHNPGTWL
Download sequence
Identical sequences G5BQ04
XP_004836339.1.39548 HGL_H00000389716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]